- Recombinant Burkholderia multivorans UPF0391 membrane protein Bmul_5473/BMULJ_06024 (Bmul_5473, BMULJ_06024)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1219856
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 5,762 Da
- E Coli or Yeast
- 19360
- UPF0391 membrane protein Bmul_5473/BMULJ_06024 (Bmul_5473, BMULJ_06024)
Sequence
MLRYALIFFVIAIIAAVFGFGGIAAGAAEIAKILFYIFVVIFLVTLLLGVVRR